Protein Info for Psyr_2303 in Pseudomonas syringae pv. syringae B728a

Annotation: UbiA prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 205 to 221 (17 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 268 to 292 (25 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 350 to 367 (18 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details amino acids 429 to 447 (19 residues), see Phobius details amino acids 461 to 482 (22 residues), see Phobius details PF01040: UbiA" amino acids 215 to 461 (247 residues), 79.3 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2303)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU26 at UniProt or InterPro

Protein Sequence (483 amino acids)

>Psyr_2303 UbiA prenyltransferase (Pseudomonas syringae pv. syringae B728a)
MPGIQGRILEVHTPLVVDLDGTLLRSDMLFETAVAFIRGHPLKLFSLFAWLLQGKASLKQ
GLALGTDIDVALLPFNADVIDYIQTERQTGRSVILATASHETLANRIAAHLQLFDHVWAS
DGRTNLSAHRKRDLLVSHYGEQGFDYIGNSRDDLCIWGVSRKAIVASPLAGVERKARAQG
NVEQVIQSATSGTSAWRKALRLHQWLKNALIFVPLLAAHQVQNTQLLLDGLLAFLCFGLC
ASSVYLLNDLLDLADDRHHRSKRERPFASGALSIKSGLLVIPLLLAAAFSAAATGLPWQF
SAVLAAYYLLTLVYSLYLKRHMAVDVIVLAMLYTTRILAGAAAFQLPLTFWILAFSMFLF
LSLALVKRYAELREARLRAVTGKTAGRGYYPGDLDMIASLGASSGNLAVMVLALYIHEGA
TVALYQHPHVIWLACPLLLFWITRIWMLTHRGEMNEDPVVFAIRDRISQGIGLLFLLVFW
VAA