Protein Info for Psyr_2254 in Pseudomonas syringae pv. syringae B728a

Annotation: Phosphonate metabolism PhnJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 80% identical to PHNJ_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-phosphate C-P lyase (phnJ) from Escherichia coli (strain K12)

KEGG orthology group: K06163, PhnJ protein (inferred from 100% identity to psb:Psyr_2254)

MetaCyc: 80% identical to carbon-phosphorus lyase core complex subunit PhnJ (Escherichia coli K-12 substr. MG1655)
RXN-17956 [EC: 4.7.1.1]; 4.7.1.1 [EC: 4.7.1.1]

Predicted SEED Role

"PhnJ protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

methylphosphonate degradation I (4/5 steps found)
(aminomethyl)phosphonate degradation (6/8 steps found)
glyphosate degradation III (5/7 steps found)
methylphosphonate degradation II (2/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.7.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU75 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Psyr_2254 Phosphonate metabolism PhnJ (Pseudomonas syringae pv. syringae B728a)
MTHAPMNTAQQRPARDEAYNFAYLDEQTKRMIRRALLKAVAIPGYQVPFGGREMPLPYGW
GTGGMQLTAAILGADDVLKVIDQGADDTTNAVSIRRFFARTAGIATTERTPEATVIQTRH
RIPETPLHADQIMVYQVPIPEPLRFIEPSETETRTMHALDDYGVMHVKLYEDIATFGHIA
TSYAYPVMVDERYVMDPSPIPKFDNPKLHMSPALMLFGAGREKRLYAVPPYTQVVSLDFE
DHPFEVQRWEQCCAICGSHDSFLDELILDDAGTQSFVCSDTDYCAQRVKQQENDR