Protein Info for Psyr_2177 in Pseudomonas syringae pv. syringae B728a

Annotation: probable sulfopyruvate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 49 to 67 (19 residues), see Phobius details PF02775: TPP_enzyme_C" amino acids 45 to 122 (78 residues), 52.5 bits, see alignment E=2.6e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2177)

Predicted SEED Role

"Sulfopyruvate decarboxylase - beta subunit (EC 4.1.1.79)" (EC 4.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.79

Use Curated BLAST to search for 4.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUF2 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Psyr_2177 probable sulfopyruvate decarboxylase (Pseudomonas syringae pv. syringae B728a)
MGQVSANHTLCRREVVKALLADRKDVLVVTGLGSASYDVMAAGDNDLNYYLWAAMGSAIT
VGLGLANAQPDKSVVVVTGDGELLMGFGALATVALQKPANLTIAVLDNGHFGETGMQVSH
AGFGISLDQVAKTCGFSWTDEIRDMEGVHNLRERFASRDGVKLATIKIKAENPPRVLPPR
DGHYVKNRFRAALGFNPI