Protein Info for Psyr_2143 in Pseudomonas syringae pv. syringae B728a
Annotation: delta1-piperideine 2-carboxylate reductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 91% identical to PY2CR_PSEUB: Delta(1)-pyrroline-2-carboxylate/Delta(1)-piperideine-2-carboxylate reductase (dpkA) from Pseudomonas syringae pv. tomato
KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2143)MetaCyc: 73% identical to Delta1-piperideine-2-carboxylate reductase (Pseudomonas putida)
Pyrroline-2-carboxylate reductase. [EC: 1.5.1.1]
Predicted SEED Role
"Delta 1-piperideine-2-carboxylate reductase (EC 1.5.1.21) / Delta 1-pyrroline-2-carboxylate reductase (EC 1.5.1.1)" in subsystem Lysine degradation (EC 1.5.1.1, EC 1.5.1.21)
MetaCyc Pathways
- trans-3-hydroxy-L-proline degradation (1/2 steps found)
- L-proline biosynthesis IV (1/2 steps found)
- L-lysine degradation V (6/9 steps found)
- N-hydroxy-L-pipecolate biosynthesis (2/4 steps found)
- L-lysine degradation II (L-pipecolate pathway) (4/9 steps found)
- superpathway of L-lysine degradation (17/43 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.5.1.1 or 1.5.1.21
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZUI6 at UniProt or InterPro
Protein Sequence (343 amino acids)
>Psyr_2143 delta1-piperideine 2-carboxylate reductase (Pseudomonas syringae pv. syringae B728a) MRANPADQSTRAVSLEQLTDLLRRIFLAHGTSAEVAGVLAENCASAQRDGSHSHGIFRIP GYLSSLASGWVDGKAVPVVEDVGAAFVRVDAGGGFAQPALAAARALLIDKARSAGIAVLA IRNSHHFAALWPDVEPFAEQGLVALSMVNSMTCVVPHGARQPLFGTNPIAFAAPRAGGEP VVFDLATSAIAHGDVQIAAREGRLLPAGMGVDRDGQPTDEPRAILEGGALLPFGGHKGSA LSMMVELLAAGLTGGNFSFEFDWSKHPGAQTPWTGQLLIVIDPDKGSGQSFAQRSEELVR QLHGAGQERLPGDRRYSERARSMAHGISIAQTDLERLQALAGH