Protein Info for Psyr_2100 in Pseudomonas syringae pv. syringae B728a

Annotation: assimilatory nitrate reductase (NADH) beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF07992: Pyr_redox_2" amino acids 5 to 283 (279 residues), 211.9 bits, see alignment E=4.3e-66 PF13738: Pyr_redox_3" amino acids 74 to 278 (205 residues), 34.4 bits, see alignment E=4.4e-12 PF00070: Pyr_redox" amino acids 147 to 228 (82 residues), 69.1 bits, see alignment E=1.1e-22 PF18267: Rubredoxin_C" amino acids 319 to 385 (67 residues), 64.1 bits, see alignment E=2.9e-21

Best Hits

KEGG orthology group: K00362, nitrite reductase (NAD(P)H) large subunit [EC: 1.7.1.4] (inferred from 100% identity to psb:Psyr_2100)

Predicted SEED Role

"Nitrite reductase [NAD(P)H] large subunit (EC 1.7.1.4)" in subsystem Nitrate and nitrite ammonification (EC 1.7.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.1.4

Use Curated BLAST to search for 1.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUM9 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Psyr_2100 assimilatory nitrate reductase (NADH) beta subunit (Pseudomonas syringae pv. syringae B728a)
MTKLKLVMIGNGMAGVRTLEELLKLSEDLYHITVFGAEPHPNYNRILLSPVLAGEQNFED
IVLNDLDWYQRNGIELLLNRRVVKIDRIKRLVIADDGTQAHYDRLLIATGSRPFILPIPG
NTLNGVIGYRDISHTRQMIDTAVTHKRAVVIGGGLLGLEAANGLSLRGMQVTVIHNGQTL
LERQLDKTSGRMLQAALEKRGLSFRLDEQTNALLGDDQGRVTAVQFNNGDRIDADLVVMA
AGIRPNTELAEQAGLPCNRGILVNDTLQTYDPRIYAIGECVSHRGIAYGLVAPLFEQARV
CANHLAQLGFARYPGSVTSTKLKVTGIDLFSAGDFLGGEGTESITLSDPIGGVYKKLVIK
NDVLVGACLYGDTADGNWYLQQIRDGQGIDAIRDHLMFGKPAAAQAACA