Protein Info for Psyr_2079 in Pseudomonas syringae pv. syringae B728a

Annotation: phosphoserine phosphatase / phosphoserine:homoserine phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02137: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein
  • amino acids 1 to 203 (203 residues), 382.8 bits, E=1.6e-119
• PF00702: Hydrolase
  • amino acids 48 to 164 (117 residues), 39.9 bits, E=6.1e-14
• PF12710: HAD
  • amino acids 66 to 160 (95 residues), 33.7 bits, E=5.3e-12

Best Hits

Swiss-Prot: 95% identical to THRH_PSESM: Phosphoserine phosphatase (PSPTO_2281) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K02203, phosphoserine / homoserine phosphotransferase [EC: 2.7.1.39 3.1.3.3] (inferred from 100% identity to psb:Psyr_2079)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.39, 3.1.3.3

Use Curated BLAST to search for 2.7.1.39 or 3.1.3.3

Sequence Analysis Tools

See Q4ZUQ0 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Psyr_2079 phosphoserine phosphatase / phosphoserine:homoserine phosphotransferase (Pseudomonas syringae pv. syringae B728a)
MEIACLDLEGVLVPEIWIAFAEKTGIESLRATTRDIPDYDVLMKQRLRILDEHGLKLADI
QEVIGTLKPLEGAVEFVNWLRERFQVVILSDTFYEFSQPLMRQLGFPTLLCHRLITDETD
RVIGYQLRQKDPKRQSVLAFKSLYYRIIAAGDSYNDTTMLGEADAGILFHAPDNVTREFP
QFPAVHTFDDLKKEFIKASNRDLML