Protein Info for Psyr_2056 in Pseudomonas syringae pv. syringae B728a

Annotation: CHAD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF05235: CHAD" amino acids 19 to 213 (195 residues), 81 bits, see alignment E=6.6e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2056)

Predicted SEED Role

"FIG00956090: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUS3 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Psyr_2056 CHAD (Pseudomonas syringae pv. syringae B728a)
MSSMVDHLVAEVLALDVKLLACQARLAVSTDSEALHDLRTTVRRLRSVLRPLRENPSAAE
LEEAARAVGQLTTPLRDMQVLAGFLEEQGLNEAAFTRNRYLESACPKVASSPELTRLLKL
IDRFPEMLRLQQRQGMLRGLRKTIEKRMDKQWHKLRVAIAEPGHDRHDLRLLIKRVRYAA
EAYPQLSHQPKNMQARLKSAQGELGDWHDHLQWLAQAAEQPDLAPCVPGWQIGIVGAERK
AEASLKRLAKACF