Protein Info for Psyr_2047 in Pseudomonas syringae pv. syringae B728a

Annotation: K+ transporting ATPase, A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 66 to 91 (26 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 375 to 400 (26 residues), see Phobius details amino acids 420 to 442 (23 residues), see Phobius details amino acids 487 to 508 (22 residues), see Phobius details amino acids 529 to 553 (25 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 3 to 562 (560 residues), 733.3 bits, see alignment E=9.4e-225 PF03814: KdpA" amino acids 11 to 560 (550 residues), 792.7 bits, see alignment E=6.8e-243

Best Hits

Swiss-Prot: 97% identical to KDPA_PSESM: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to psb:Psyr_2047)

MetaCyc: 54% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUT2 at UniProt or InterPro

Protein Sequence (564 amino acids)

>Psyr_2047 K+ transporting ATPase, A subunit (Pseudomonas syringae pv. syringae B728a)
MHSYDYLLILAFLVLLLAPAPWLGRFYYRVMEGERTWLSPLLGPVERACYRISGVDPKTE
QSWQQYAWALLAFNLAGFVVLFAILMLQGVLPLNPQQLPGMEWSLAFNTTMSFVANTNWQ
AFSGEASLSYLSQMVGLTVQNFVSAATGLAVLVALCRGISRRSSQSLGNFWADMTRATLY
GLLPISIVLAVFLVWQGVPQNFGHYIDALTLQGADQSLPMGPAASQISIKQLGTNGGGFF
GVNSAHPFENPTAWSNLFELVSILLIPAALVFTFGHYVKDMRQSRAILGCMLALLLIGGA
VSLWAEYQPNPALNIAGVEQTAPLEGKETRFGTTGTVLWSVATTAASNGSVNGMHDSLNP
LTGMVALVNMMVGEVIFGGVGVGLNGMLLNVLIAVFLAGLMIGRTPEYLGKKLQAQEVRL
LVATLLVMPVGVLVLGAIAASLPGPAGAVSNPGPHGFSQLLYAYTSATANNGSAFGGFSA
NTVFHNLMLSLAIFIGRFGYILPVLALAGSLAMKKAAPQGQNSFPTHGLLFVTLLTVTIL
LVGGLTFLPTLALGPIAEHLSLGF