Protein Info for Psyr_2030 in Pseudomonas syringae pv. syringae B728a

Annotation: Calcium-binding EF-hand

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF13202: EF-hand_5" amino acids 31 to 49 (19 residues), 14 bits, see alignment (E = 8.7e-06) amino acids 102 to 123 (22 residues), 20 bits, see alignment (E = 1.1e-07) amino acids 136 to 156 (21 residues), 22.6 bits, see alignment (E = 1.7e-08) PF13499: EF-hand_7" amino acids 104 to 159 (56 residues), 30.2 bits, see alignment E=1.4e-10 PF13833: EF-hand_8" amino acids 116 to 155 (40 residues), 17.5 bits, see alignment 8.3e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2030)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FkpA precursor (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUU9 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Psyr_2030 Calcium-binding EF-hand (Pseudomonas syringae pv. syringae B728a)
MISGISSSFSSYTSSTSATSSTSNKKFQEELLAKLDTDGDGSIAKNELSSALSSNSKDGV
TVSLSKAFSDLDSNDDDSLDADELAAMTPPPPPMQSVDEQAEDLLGALDSDGDGAISSDE
LTTGLSNTGSTANSNQVFDALDTDEDGTVSLEELVAGMQPQQPSAGMSSAQVSTSSATES
SSLFSTLDSNSDDSISASELSAALKQSDSTIDQGNTDQIATQALNKMIAALSEKYDTQSS
KPVGKYLDTAA