Protein Info for Psyr_1987 in Pseudomonas syringae pv. syringae B728a

Annotation: 2-keto-3-deoxygalactonate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF05035: DGOK" amino acids 9 to 316 (308 residues), 328 bits, see alignment E=1.9e-102

Best Hits

KEGG orthology group: K00883, 2-dehydro-3-deoxygalactonokinase [EC: 2.7.1.58] (inferred from 100% identity to psb:Psyr_1987)

Predicted SEED Role

"2-dehydro-3-deoxygalactonokinase (EC 2.7.1.58)" in subsystem D-galactonate catabolism (EC 2.7.1.58)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.58

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUZ2 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Psyr_1987 2-keto-3-deoxygalactonate kinase (Pseudomonas syringae pv. syringae B728a)
MQAQLIALDWGTTSLRAYRLGEHGQVLEQRALSAGIMQLPTTPRLIAGQFCSDGFELAFD
QACGDWLDAQPDLQVIACGMVGSAQGWREAAYRETPASVNELSAALQTVRSVRGVTVHII
PGVLQRSTLPNVMRGEETQVLGVLAGLEDGQGSQPLLIGLPGSHSKWVQVERGRIVHFDT
FMTGEVYAALCAHTILGRTMQPAEAFDEQAFDRGLSIALSDAGSAGPLSTIFSTRTLGLT
GQLSASAQPDYLSGLLIGHELGAIARLHLHNHEQLPAVILIGSDSLCTRYARGLAVCGFP
GVTLAEQATERGLWQVAVQAGLIARRSSQHIREV