Protein Info for Psyr_1977 in Pseudomonas syringae pv. syringae B728a

Annotation: glutamyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 TIGR00464: glutamate--tRNA ligase" amino acids 3 to 468 (466 residues), 464 bits, see alignment E=3e-143 PF00749: tRNA-synt_1c" amino acids 4 to 320 (317 residues), 368.2 bits, see alignment E=2.9e-114 PF19269: Anticodon_2" amino acids 333 to 471 (139 residues), 120.9 bits, see alignment E=5.7e-39

Best Hits

Swiss-Prot: 100% identical to SYE_PSEU2: Glutamate--tRNA ligase (gltX) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 100% identity to psb:Psyr_1977)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV02 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Psyr_1977 glutamyl-tRNA synthetase (Pseudomonas syringae pv. syringae B728a)
MTTVRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQIFD
ALRWLGIDWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVDMGHAFPCFCTAEELDQMRAE
QQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPWDR
MDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQLCY
MPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREKFSLQEMVDN
FDLSRVSLGGPIFDIEKLSWLNGQWLRDLPVEEFASRLKTWALNPDYMMKIAPHVQGRVE
TFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKERIMGCI
QAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGGVSKK
ENKEWEKLLGSIA