Protein Info for Psyr_1975 in Pseudomonas syringae pv. syringae B728a

Annotation: Integrase, catalytic region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13276: HTH_21" amino acids 29 to 84 (56 residues), 66.9 bits, see alignment E=3e-22 PF00665: rve" amino acids 107 to 205 (99 residues), 92.3 bits, see alignment E=4.2e-30 PF13683: rve_3" amino acids 194 to 259 (66 residues), 51.2 bits, see alignment E=1.8e-17 PF13333: rve_2" amino acids 212 to 265 (54 residues), 72.4 bits, see alignment E=5.2e-24

Best Hits

Swiss-Prot: 56% identical to INSK_ECOLI: Putative transposase InsK for insertion sequence element IS150 (insK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to psb:Psyr_2654)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV04 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Psyr_1975 Integrase, catalytic region (Pseudomonas syringae pv. syringae B728a)
MCALLTLAGLARSTFYYQAQVQSRPDPDAALKQEIERIYHEERGLYGARRITAVIRNSGT
LVNKKVVERLMAELGLRSVVRPKKYRSYKGTVGKIAPNLLERKFTAQRPNQKWVTDVTEF
KVANRKLYLSPVMDLYNGEIVAYEVSTRPCFELVTNMLDKALQQLQDEPKLVMHSDQGWQ
YQHAQYRQKLAVKGVKQSMSRKGNCLDNAAMESFFGTLKSEFFYLKRFESIEELKAGLDE
YIRYYNNDRIKLKLNGLSPVKYRAQAAS