Protein Info for Psyr_1970 in Pseudomonas syringae pv. syringae B728a

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 382 (345 residues), 146.4 bits, see alignment E=4.8e-47 PF16576: HlyD_D23" amino acids 47 to 265 (219 residues), 62.9 bits, see alignment E=5.4e-21 PF13533: Biotin_lipoyl_2" amino acids 64 to 105 (42 residues), 30.4 bits, see alignment 5.3e-11 PF13437: HlyD_3" amino acids 186 to 266 (81 residues), 38.9 bits, see alignment E=2.5e-13

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 100% identity to psb:Psyr_1970)

Predicted SEED Role

"pyoverdine-specific efflux macA-like protein" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV09 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Psyr_1970 Secretion protein HlyD (Pseudomonas syringae pv. syringae B728a)
MKRSRHPRRALLVALCLFPVIAVCAWQILPDSKSSAATVTVTRGTIENSVTALGTLQPRS
YVDVGSQASGQIMKIHAQVGDQVKEGDLLVEIDPSTQKAKLDAARYAIDNLKAQLQEQRA
LHELAEQKQQRQKRLAAGGATRAEDVQAAESEFRATQARVDMFKAQILEAQAALRSDEAA
LGYTRIFAPMSGTVVALDAREGQTLNAQQQTPLILRIARLSPMTVWAEVSEADIGHVKPG
MTAYFTTLSGGNRRWSSTVRQILPVPPRPLDQANQGGGSPSSARKNGGGRVVLYTVLLDV
DNSDQALMAEMTAQIFFVADKAENTLTAPLAALRNGAQTDRQTAQVLSANGEVQNRQVRT
GISDRLRVQVLDGLNEGERLLVPASVGSGG