Protein Info for Psyr_1949 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details PF00950: ABC-3" amino acids 25 to 286 (262 residues), 174.2 bits, see alignment E=3.9e-55 PF01032: FecCD" amino acids 62 to 284 (223 residues), 36.6 bits, see alignment E=2.8e-13

Best Hits

Swiss-Prot: 30% identical to ZNUB_ECOLI: High-affinity zinc uptake system membrane protein ZnuB (znuB) from Escherichia coli (strain K12)

KEGG orthology group: K09816, zinc transport system permease protein (inferred from 100% identity to psb:Psyr_1949)

MetaCyc: 30% identical to Zn2+ ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"ABC transporter in pyoverdin gene cluster, permease component" in subsystem Siderophore Pyoverdine

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV30 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Psyr_1949 ABC-3 (Pseudomonas syringae pv. syringae B728a)
MDYETFRLFIQGLASSGYLPEALAYGFVVNALLAGLLIGPVLGGLGTLVVVKRFAFFSEA
VGHAALTGVAIGILLGEPYTGPYGALFGYCLLFGIVLNYLRNRTGLAPDTLIGVFLSVSL
ALGASLLLVLAGKINVHILENVLFGSVLTVNGNDLLVLLIVGSLVMGLSLPLYNRIMLAS
FNPQLAAVRGVAVKTLDYLFVILVTLITVAAVKVIGAILVGALLVIPAAAARLLSQSLKG
FFWISVAIATISTLCGILLPIVFDLPVPSGAAIILVAGIAFALAAIARGTLPSLKGNIG