Protein Info for Psyr_1941 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-binding region, ATPase-like:Histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF07730: HisKA_3" amino acids 189 to 256 (68 residues), 58.1 bits, see alignment E=1.1e-19 PF02518: HATPase_c" amino acids 294 to 388 (95 residues), 41.3 bits, see alignment E=1.9e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1941)

Predicted SEED Role

"Sensor protein DegS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV38 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Psyr_1941 ATP-binding region, ATPase-like:Histidine kinase (Pseudomonas syringae pv. syringae B728a)
MQSPPHDPASALAIRNQYRQSQSRAARLRLLVDTGQELTHLPPQAMRQRVLQRACAFVAM
DHGLLLEWSADNGVQTTASHGSAERLATLETAADPLAIGPQWLDRPAADLPCMLLLPLRG
ADEGSFGTLLLANSVGINAPDNEDIESLQLLATLLAAHLENNRLLDALVVREQTMSELVR
QLFTAQEDERKRMAYDLHDGLAQTLAGLHQRLQGFAGRCPDLPEPLDADLQAILKLAQHC
VGEGRQLISGLRPSVLDDFGLLQAVDKDADRLREAGVAVHWRSRSLTRLPSHLEIALFRI
AQEGINNVLKHASAGRVELALELSEEHISLLLEDNGSGFITQKPFNGKGVQKLGLVAMQE
RASLLGGRLTCVSRPGHGTRLRAIVPFTADKAMT