Protein Info for Psyr_1912 in Pseudomonas syringae pv. syringae B728a

Annotation: Response regulator receiver:Stage II sporulation E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 206 to 227 (22 residues), see Phobius details PF00072: Response_reg" amino acids 9 to 110 (102 residues), 101.6 bits, see alignment E=2.9e-33 PF07228: SpoIIE" amino acids 200 to 391 (192 residues), 122.1 bits, see alignment E=2.8e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1912)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV66 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Psyr_1912 Response regulator receiver:Stage II sporulation E (Pseudomonas syringae pv. syringae B728a)
MPKTSAKLLIIDDDDVVRASLAAYLEDSGFSVLQASNGLQGIQIFEQENPDLVVCDLRMP
QMGGLELIRQVTAIAPQTPVIVVSGAGVMSDAVEALRLGAADYLIKPLEDLAVLEHSVRR
ALDRARLLTENQVYREKLEKANRELEASLHLLQEDQDAGRQVQMNMLPITPWSIDAFKFA
HQIIPSLYLSGDFVDYFRVDERRVAFYLADVSGHGASSAFITVLLKFMTTRLLFESKRGG
TLPEFKPSDVLGHINRGLISCKLGKHVTMVGGVIDEESGKLTYAVGGHLPLPVLYSEGQA
HYLEGRGLPVGLFNEATYQDHEIDLPESFSLTMLSDGILDLLPGDTLKEKEAVLPELVKA
AGGSLDGLQRVFELATLGEMPDDIALLVLSRNLE