Protein Info for Psyr_1907 in Pseudomonas syringae pv. syringae B728a

Annotation: GTP cyclohydrolase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR03138: queuine synthase" amino acids 33 to 304 (272 residues), 401.2 bits, see alignment E=1.3e-124 PF14819: QueF_N" amino acids 44 to 154 (111 residues), 158.1 bits, see alignment E=9.7e-51 PF14489: QueF" amino acids 218 to 292 (75 residues), 69.7 bits, see alignment E=2e-23

Best Hits

Swiss-Prot: 100% identical to QUEF_PSEU2: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 100% identity to psb:Psyr_1907)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV71 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Psyr_1907 GTP cyclohydrolase I (Pseudomonas syringae pv. syringae B728a)
MAGQSGFSLKAPGKRYKLAAFIHDPGIAMHPAAEHSPLGKSSEYIATYTPSLLFPIPRAA
KWAELGLTAQTLPYQGVDFWNCYELSWLLPSGKPVVAIGEFSIPAESPNIIESKSFKLYL
NSLNQTAFATVEQLQTTLEQDLSAAAGKPVGVRIRSLAEIEEEGVAALPGVCIDDLDISV
SSYDRPQPELLCCDDSRVVAESVHSHLLKSNCPVTSQPDWGSVVVEYRGAALDHASLLAY
IVSFRQHSDFHEQCVERIFLDLQRLLKPEKLTVYARYVRRGGLDINPYRSTETLDVDNRR
LARQ