Protein Info for Psyr_1904 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF214

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details amino acids 317 to 345 (29 residues), see Phobius details amino acids 349 to 359 (11 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 5 to 416 (412 residues), 554.3 bits, see alignment E=8.9e-171 PF12704: MacB_PCD" amino acids 27 to 193 (167 residues), 53.7 bits, see alignment E=3.6e-18 PF02687: FtsX" amino acids 276 to 409 (134 residues), 62.3 bits, see alignment E=4.6e-21

Best Hits

Swiss-Prot: 45% identical to LOLC_XYLFA: Lipoprotein-releasing system transmembrane protein LolC (lolC) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to psb:Psyr_1904)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV74 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Psyr_1904 Protein of unknown function DUF214 (Pseudomonas syringae pv. syringae B728a)
MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL
GMVPHATIESADPITDWRGLAAKVQENPQVLAVAPFTQMQGLLTHDGKVQKVLLNGIDPL
EERKVSIIDHFIKQGQLDSLSPGSFGIMIGDKAAAKLGVGIGDKLTFVAPEVTVTPAGMF
PRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLGRLHRWKPNQVQGLRLKFDDLFAAPRTSW
EIAQKLGENNFYSRDWTRTHGNLYQAIRMEKAMIGLLLLLIVAVAAFNIISTLVMVVNDK
KGDIAILRTLGATPRQIMAIFMVQGTVIGVVGTLIGAALGILAALNVSAAIAALEGLIGH
KFLNADVYFIDYLPSQLMAQDVFQVCGAALVLSFLATLYPAWRAARTQPAEALRYE