Protein Info for Psyr_1830 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter, transmembrane region:ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 signal peptide" amino acids 26 to 26 (1 residues), see Phobius details transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 145 to 162 (18 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 9 to 584 (576 residues), 893.7 bits, see alignment E=2.9e-273 PF00664: ABC_membrane" amino acids 30 to 296 (267 residues), 181.1 bits, see alignment E=3.6e-57 PF00005: ABC_tran" amino acids 364 to 513 (150 residues), 112.2 bits, see alignment E=3.1e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to psb:Psyr_1830)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVE5 at UniProt or InterPro

Protein Sequence (589 amino acids)

>Psyr_1830 ABC transporter, transmembrane region:ABC transporter (Pseudomonas syringae pv. syringae B728a)
MISRITRRHRQALRLAASFIAPYRWQALGALLALVITAGITLSIGQGIKLMVDQGFMTRS
PQLLERSIGFFMLLTVGLAVGTFARFYLVSWIGERVVADLRKKVFDHLIELHPGFYENNR
SSEIQSRLTADTTLLQSVIGSSLSMFLRNALMVIGGIVLLFITNPKLTSIVVVALPLIIA
PILMFGRRVRNLSRESQDRVANVGSYVAEALGQIKTVQAYNHQQQDKQRFSHTVEQAFET
ARKRILQRSWLITLVIVLVLGAVAVMLWVGGMDVISGRISSGELAAFVFYALMVGMAFGT
LSEVIGDLQRAAGAAERIGELLQARSEISVPTTDLQSLPPRISGRLALENVTFAYPSRPE
RNALDNLTLSIEPGETLALVGPSGAGKSTILDLLLRFYDPIQGRILIEGVPIAQLDHHDL
RRCFALVSQSPALFFGTVEDNIRYGNATASLEQVQAAARIAHAHEFILDMADGYRTHLGE
GGVGLSGGQRQRLAIARALLVDAPILLLDEATSALDAQSEHLIQQALPSLMQGRTTLVIA
HRLATVQNADRIAVMDQGRLVAVGTHQQLIASNPLYARLAALQFNAGVE