Protein Info for Psyr_1736 in Pseudomonas syringae pv. syringae B728a

Annotation: Helix-turn-helix, Fis-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 PF00158: Sigma54_activat" amino acids 314 to 477 (164 residues), 217.4 bits, see alignment E=2e-68 PF14532: Sigma54_activ_2" amino acids 323 to 482 (160 residues), 64.8 bits, see alignment E=2e-21 PF02954: HTH_8" amino acids 587 to 613 (27 residues), 33.9 bits, see alignment (E = 4.3e-12)

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1736)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVN8 at UniProt or InterPro

Protein Sequence (617 amino acids)

>Psyr_1736 Helix-turn-helix, Fis-type (Pseudomonas syringae pv. syringae B728a)
MSQTSASLAHDIIIQDSWTRCRDFGLSHQTRPSFGQLPGTEVSRLLERHHGLVQTTHQEV
LPVYENILSNSSCLILLADRQGQLLKSWGAQRFVESSQAQGFMPGASWNERGTGTNAIGT
ALACEEAIHIEPDEHFLKANRFMTGSASPIFDADRRIIAVLDVSSDSFLPPSHTLGMVKM
MSQSVENRLILDQFRDSHFQLIFNTGLNNLDSQWAGLLIFDESGQILCANRRADTLLGTA
PAGASIETLFKCPILQLLSETEARPFALHAFGNNRFQCLLKRPTRKPLKLHCVQAAQVPA
APRNLDLQAISLGDAKVEKAVRQAQRLLEKDIPLLIHGETGVGKEVFVKALHQASARASQ
PLIAVNCAAIPADLVEAELFGYERGAFTGANQKGSIGLIRKADKGTLFLDEVGDMPMPVQ
ARLLRVLQERCVQPLGSSELYPVDIRLISATNRGLRDQVQAGLFRQDLYYRISGLSIELP
PLRERTDKHALIQRIWERHRDAHQRAGFSREVLELFEHHPWPGNLRQLNSVIQVALALAD
EQPIGTDHLPEDFLLDAHADEECRVPLRTQESATRFHSSEDLGQLFQAAGGNVSQLAKRL
GVSRNTLYKRLREQRIV