Protein Info for Psyr_1682 in Pseudomonas syringae pv. syringae B728a

Annotation: arsenite efflux membrane protein ArsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 95 to 127 (33 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 372 to 389 (18 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details TIGR00935: arsenite/antimonite efflux pump membrane protein" amino acids 3 to 426 (424 residues), 676.3 bits, see alignment E=1.1e-207 PF02040: ArsB" amino acids 4 to 423 (420 residues), 494.8 bits, see alignment E=2.9e-152 PF03600: CitMHS" amino acids 13 to 368 (356 residues), 212.7 bits, see alignment E=8.2e-67

Best Hits

Swiss-Prot: 70% identical to ARSB1_ECOLX: Arsenical pump membrane protein (arsB) from Escherichia coli

KEGG orthology group: K03893, arsenical pump membrane protein (inferred from 100% identity to psb:Psyr_1682)

MetaCyc: 72% identical to arsenical pump membrane protein (Shewanella sp. ANA-3)
RXN-22366 [EC: 7.3.2.7]

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVU2 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Psyr_1682 arsenite efflux membrane protein ArsB (Pseudomonas syringae pv. syringae B728a)
MLIATLIFLFTITLVIWQPKGLGVGWSAVLGAILALLTGVVHVSDIAVVWGIIWNATATF
ISLIIITLLLDEAGFFAWAALHVARWGKGNGRRLFALFVLFGALVSALFANDGAVLILTP
IVIAMMLALRFSPASTLAFVMAAGFIADTASLPLVVSNLVNIVSADYFKIGFNRYAAVMV
PVNLASVAATLAVLMWYFRRDIPAEFEPEQLDKPETVIHDRATFLAGWAVLVILLVGCFA
LEPLGIPISAISSVCAVLLLAIAAKGHTIKTRKVMKEAPWHIVVFSLGMYLVVYGLRNAG
LTDYLANLLDWFAGYGIWGAAMGTGVMTAFLSSIMNNMPTVLIGLLSIDASHASGAIQEA
MIYANVIGSDLGPKITPIGSLATLLWLHVLQRKGITISWGYYFKVGIVLTVPVLLVTLAA
LALRLS