Protein Info for Psyr_1641 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidase S49, SppA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 81 to 287 (207 residues), 157 bits, see alignment E=2.5e-50 PF00574: CLP_protease" amino acids 93 to 170 (78 residues), 21.5 bits, see alignment E=1.9e-08 PF01343: Peptidase_S49" amino acids 144 to 294 (151 residues), 114.1 bits, see alignment E=6.2e-37

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 99% identity to psp:PSPPH_1635)

Predicted SEED Role

"Periplasmic serine proteases (ClpP class)"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVY3 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Psyr_1641 Peptidase S49, SppA (Pseudomonas syringae pv. syringae B728a)
MSDEWKAPVSQSADEGINGREEAKSWKLLEKTLLASVQEQRRARRWGIFFKLLTFAFLFV
AVIVPMLDFEGGTSRRSSHTALIDVQGVIADKEAASAENIVTALQKAFEDEKTKGVILRI
NSPGGSPVQSGYVYDEIRRLRAAKPDIKVYAVITDLGASGAYYIASAADQIYADKASLVG
SIGVTAAGFGFVGAMDKLGVDRRTYTSGEHKAFLDPFQPQKADETQFWQGVLDTTHRQFI
ASVKQGRGDRLKDKDHPELFSGLIWTGEQAVALGLVDGLGSASYVARDVIKEKDIVEYTV
EESPFDRFSKKLGTSIAERIAMLVGFNGPSLR