Protein Info for Psyr_1587 in Pseudomonas syringae pv. syringae B728a

Annotation: Bile acid:sodium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 126 to 151 (26 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 267 to 299 (33 residues), see Phobius details PF13593: SBF_like" amino acids 14 to 303 (290 residues), 75.2 bits, see alignment E=5.8e-25 PF01758: SBF" amino acids 42 to 219 (178 residues), 150.2 bits, see alignment E=5.8e-48

Best Hits

Swiss-Prot: 56% identical to YOCS_BACSU: Uncharacterized sodium-dependent transporter YocS (yocS) from Bacillus subtilis (strain 168)

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 100% identity to psb:Psyr_1587)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW37 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Psyr_1587 Bile acid:sodium symporter (Pseudomonas syringae pv. syringae B728a)
MRALAALSRFVGNTFAYWVLLFAILAFLFPQAFIGLKSWIVPLLGLVMFGMGLTLKLEDF
SEVARNPWRVALGVIAHFVIMPGVAWLLCQVFQLPPEIAVGVILVGCCPSGTSSNVMAWL
AKGDLALAVAIAAVTTLLAPLLTPTLIWFLASAWLPVSFLDMFWSILQLVMLPIVLGVIA
QRLLGARVSYAVDVLPLVSVVSIVMIVCAVVAASQAKIAESGLLIMAVVILHNTFGFLLG
YFTGKVFKLPLAQRKSLALEVGMQNSGLGAALASAHFSPLAAVPSALFSVWHNISGALLS
TYFRKMPEEENTSVR