Protein Info for Psyr_1491 in Pseudomonas syringae pv. syringae B728a

Annotation: Histidine kinase, HAMP region:Bacterial chemotaxis sensory transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details PF02203: TarH" amino acids 4 to 170 (167 residues), 55 bits, see alignment E=2e-18 PF12729: 4HB_MCP_1" amino acids 14 to 182 (169 residues), 59.4 bits, see alignment E=7e-20 PF00672: HAMP" amino acids 207 to 258 (52 residues), 38.6 bits, see alignment 2.2e-13 PF00015: MCPsignal" amino acids 344 to 503 (160 residues), 141.4 bits, see alignment E=5.4e-45

Best Hits

Swiss-Prot: 44% identical to NAHY_PSEPU: Methyl-accepting chemotaxis protein NahY (nahY) from Pseudomonas putida

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to pst:PSPTO_4624)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWD1 at UniProt or InterPro

Protein Sequence (539 amino acids)

>Psyr_1491 Histidine kinase, HAMP region:Bacterial chemotaxis sensory transducer (Pseudomonas syringae pv. syringae B728a)
MRLRNINLAPRATLFFSAIILLVVVLGVIAILQMGKLRDTEKDVELNWLPSIRQTAMMNS
TVLRVRLETQRAVADPQTVQQTIVKFPAYRKAMKDAVYNYETLIASDQERQLFLAVKKSY
DDYASQLDLLEPLLKAGDTASIVKLVATGIRPLTNQMETQVEELTQFNNKGAALAGVQAT
QVYDSGLYIVIGLIIFVALLTLCLATLLTKTITSPIGSALSVAERIASSDLTKEVEVSGT
DEAGRLLSALATMQQNLRSTIMQIADSSSQLAAASEEMTAVTEQSSLGLVSQNDEVNQAA
TAVTEMSAAVDEVARNAESASEESRKGQGYTEVGLERVSQTLKSIEKLSSNVRDTSEQIT
GLSNRAQNISKVVEVIRAIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAHRTQV
STQEIEQMIQAIQNDSDQAVKAMATSRELAAESLSVAGDASSSLDQIATAITGINERNIL
IATASEEQAHVAREVDRNLVSIRELASQSSAGASQTASACNEMSKLAVSLNQLVNRFKV