Protein Info for Psyr_1433 in Pseudomonas syringae pv. syringae B728a

Annotation: C-5 cytosine-specific DNA methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF00145: DNA_methylase" amino acids 191 to 452 (262 residues), 80.9 bits, see alignment E=5.9e-27

Best Hits

KEGG orthology group: K00558, DNA (cytosine-5-)-methyltransferase [EC: 2.1.1.37] (inferred from 100% identity to psb:Psyr_1433)

Predicted SEED Role

"Type II restriction-modification system methylation subunit"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.37

Use Curated BLAST to search for 2.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWI8 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Psyr_1433 C-5 cytosine-specific DNA methylase (Pseudomonas syringae pv. syringae B728a)
MNTFSLLITPKIGEARGVPRIWLEGQKLLNAGIEIGTRFSLIRPEGQTRLELVPATSPEL
NTGDVTVSRRVKNGITTPLIEIRTALLRGLFKTAEKVRVVIRLGRIVITPLDNDKRIEER
LARLKRKLDAQEPLAVCSLFHGGGVLDRAIHAGLARSGIDTFVRIGIEVEDQYLDASLRN
NPMLWRDTSFAICADVRDVQRGTGTPECDLVVAGIPCTGASRAGKAKNKLSSAEQHPSAG
SLFIDFLDFVRYSNPVMAIVENVPDYQTSTSMEVIRSVLKSLGYRLFECILDGAVFGAFE
SRSRMALVAYTEGAFEPLTLDQITPLRTKERSLKDLMDVVPETDESWKCYDYLGRKEERD
IASGKGFRRQLLTPEATSCGCIGRGYAKARSTEPFIRHPRNPALSRLLTVSEHARVKTIP
VEIVEGVSNTTAHEILGQSVIYAAFEAIAATVGKLITKLHRTARPAGVMAA