Protein Info for Psyr_1417 in Pseudomonas syringae pv. syringae B728a

Annotation: TPR repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF16331: TolA_bind_tri" amino acids 35 to 91 (57 residues), 44.7 bits, see alignment E=4.1e-15 TIGR02795: tol-pal system protein YbgF" amino acids 128 to 245 (118 residues), 137.6 bits, see alignment E=1.5e-44 PF13525: YfiO" amino acids 129 to 210 (82 residues), 26.3 bits, see alignment E=2.2e-09 PF13174: TPR_6" amino acids 132 to 161 (30 residues), 16.9 bits, see alignment 2.9e-06 amino acids 167 to 197 (31 residues), 19.1 bits, see alignment 5.5e-07 amino acids 203 to 234 (32 residues), 21.3 bits, see alignment 1.2e-07 PF13432: TPR_16" amino acids 136 to 197 (62 residues), 32.7 bits, see alignment E=2.8e-11 PF14559: TPR_19" amino acids 176 to 242 (67 residues), 25.1 bits, see alignment E=6.3e-09

Best Hits

Swiss-Prot: 75% identical to CPOB_PSEPU: Cell division coordinator CpoB (cpoB) from Pseudomonas putida

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1417)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWK4 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Psyr_1417 TPR repeat protein (Pseudomonas syringae pv. syringae B728a)
MVDNNSGSGSSSYPPAGYGTSGAYAGGGVTAPASAQGQLFMQLQQMQDEIARLRGVVEVQ
QNDIQRMKQEALERYQELDQRIASGSAAPATNNSQPAGGAIDAGGTPSAPAAQQAPAAGT
EPPDPAKEKLYYEAAFDLIKAKDFDKASQAFTAFLRKYPNSSYAGNAQYWLGEVNLAKGD
LQGAGQAFAKVSQQYPKHAKVPDSLYKLADVERRLGHTDKVKGILQQVVAQYPGTSAAQL
AQRDLQRL