Protein Info for Psyr_1413 in Pseudomonas syringae pv. syringae B728a

Annotation: Cell division and transport-associated protein TolR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details PF02472: ExbD" amino acids 12 to 152 (141 residues), 94.6 bits, see alignment E=2.6e-31 TIGR02801: protein TolR" amino acids 15 to 152 (138 residues), 145 bits, see alignment E=9.4e-47

Best Hits

Swiss-Prot: 78% identical to TOLR_PSEAE: Tol-Pal system protein TolR (tolR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03560, biopolymer transport protein TolR (inferred from 100% identity to pst:PSPTO_3974)

Predicted SEED Role

"Tol biopolymer transport system, TolR protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWK8 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Psyr_1413 Cell division and transport-associated protein TolR (Pseudomonas syringae pv. syringae B728a)
MALIARDRRRKRKPVAEMNVVPYIDVMLVLLVIFMVTAPMINQGVKVDLPKVSSEALPQD
NNNQVLTISIKADKTYYWNLGSEVDTDKQMDKAMTLPQLTAAVTKIVAAGRDAGKQTQVF
IRGDKTVDYGSVMGTMGGLQKAGVGNVGLITEAP