Protein Info for Psyr_1396 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF470:Protein of unknown function DUF471:Protein of unknown function DUF472

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 880 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 422 to 442 (21 residues), see Phobius details amino acids 448 to 466 (19 residues), see Phobius details amino acids 478 to 499 (22 residues), see Phobius details amino acids 522 to 541 (20 residues), see Phobius details amino acids 775 to 794 (20 residues), see Phobius details amino acids 859 to 878 (20 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 37 to 328 (292 residues), 39.6 bits, see alignment E=4.5e-14 PF09924: LPG_synthase_C" amino acids 566 to 852 (287 residues), 300.1 bits, see alignment E=1.5e-93

Best Hits

KEGG orthology group: K14205, phosphatidylglycerol lysyltransferase [EC: 2.3.2.3] (inferred from 100% identity to psb:Psyr_1396)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWM5 at UniProt or InterPro

Protein Sequence (880 amino acids)

>Psyr_1396 Protein of unknown function DUF470:Protein of unknown function DUF471:Protein of unknown function DUF472 (Pseudomonas syringae pv. syringae B728a)
MRDNMSDSNETIDAEQPVSPPRHNWRELLSKYRQPIGLAVMLLLFSLALIACRHMLVEMD
WYALHDSLFAVPLPALGGALLAAIVGYIILMGYELSASRYANVDLPIKTLLLGGFTSFAI
GNAVGLSMLSGGSVRYRLYSRHGVGAIEIARMTVFASLSLGCALPPLAALATLSNLSGAS
LALKLPVDVLAVVATAVLIGSLLLAVLIYRRRLPEQDIPHNILVRLGRRTLRLPDLKLTL
IQLVITALDVAAAAMVLYLLLPHAPPLGAFILIYLLALAAGVLSHVPGGVGVFEAILLAA
FANELGAAPLAAALLLYRLIYVILPLLLACLTLLFTEAQRLLPTRQAMRVASGLAAPILA
LLVFLSGVVLLFSGATPEIDTRLENVGFMIPHRLIDASHFGASLVGVLCLLLAQGLRRRL
SAAWMLTSILLLVGAVLSILKGFDWEEASMLLLTACLLLTFRRSFYRPSRLLELPFSPVY
LIASICVVGASIWLLLFAYQDVPYSHQLWWQFTLDADAPRGLRSALGSAVLLVVVSLTWL
LRTARPVIKLPDAEDLDKAAEILKASKQPDGGLVLTGDKAILFHPAGNAFLMYSHRGRSL
VALYDPIGPTQQRAELIWQFRDLCDVHHARPVFYQVRAENLPFYMDIGLTAIKLGEEARV
DLHRFDIDAKGKEMKDLRYTWNRGGRDGLSLEIYEPGQAPIDELKVISDAWLTGKNVREK
GFSLGRFSTEYLKYFRIAIVHFQGKPVAFSNLLETTSPELASLDLMRSHPDAPKLTMEFM
MVGLILHYKAQGYARFSLGMVPLSGLQPRRGAPITQRLGSMIFRRGEQLYNFQGLRRFKD
KFQPDWEPRYMAVPAGLDPLVALADTAALIAGGLTGLVKR