Protein Info for Psyr_1391 in Pseudomonas syringae pv. syringae B728a

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF13673: Acetyltransf_10" amino acids 47 to 126 (80 residues), 47.5 bits, see alignment E=2.7e-16 PF00583: Acetyltransf_1" amino acids 52 to 120 (69 residues), 43.4 bits, see alignment E=5.6e-15 PF13508: Acetyltransf_7" amino acids 59 to 122 (64 residues), 48.5 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 44% identical to YJAB_ECOLI: Peptidyl-lysine N-acetyltransferase YjaB (yjaB) from Escherichia coli (strain K12)

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to psb:Psyr_1391)

MetaCyc: 44% identical to peptidyl-lysine N-acetyltransferase YjaB (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWN0 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Psyr_1391 GCN5-related N-acetyltransferase (Pseudomonas syringae pv. syringae B728a)
MQLYTPDTRDYPELTEVWERSVRATHDFLPDAYITRLKGLLPQYLSSVTLFCTRDEQLNI
TGFAGAHKDSLDILFIDPDHRGQKLGTQLLTHAIEQFNIRELDVNEQNTQALGFYRRHGF
EVVSRSEIDGLGQPYPMLRMRLIGHH