Protein Info for Psyr_1330 in Pseudomonas syringae pv. syringae B728a

Annotation: 23S rRNA m(1)G-745 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF21302: Zn_ribbon_RlmA" amino acids 3 to 45 (43 residues), 73 bits, see alignment 5.3e-24 PF13489: Methyltransf_23" amino acids 69 to 132 (64 residues), 27.7 bits, see alignment E=7.4e-10 PF13847: Methyltransf_31" amino acids 84 to 124 (41 residues), 30.2 bits, see alignment 1.1e-10 PF08242: Methyltransf_12" amino acids 86 to 141 (56 residues), 30.2 bits, see alignment E=2.2e-10 PF08241: Methyltransf_11" amino acids 86 to 168 (83 residues), 37.4 bits, see alignment E=1.2e-12 PF13649: Methyltransf_25" amino acids 86 to 168 (83 residues), 43.7 bits, see alignment E=1.3e-14

Best Hits

KEGG orthology group: K00563, 23S rRNA (guanine745-N1)-methyltransferase [EC: 2.1.1.187] (inferred from 100% identity to psb:Psyr_1330)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase A (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.51

Use Curated BLAST to search for 2.1.1.187 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWU1 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Psyr_1330 23S rRNA m(1)G-745 methyltransferase (Pseudomonas syringae pv. syringae B728a)
MLTCPICSAPLSTADNGVVCPANHRFDRARQGYLNLLPVQHKNSRDPGDNQAMVEARRDF
LNAGHYAPVARRLAELAAERSPAHWLDIGCGEGYYTAQIAEALPHADGYALDISREAVKR
ACRRDPALTWMVASMARVPLADASCQFLASVFSPLDWQEAKRLLTPGGGLMRVGPTNEHL
MELRQRLYDEVRDYADDKHLSLVPQGMQLQHSETLRYTLKLIDGQSRADLLAMTPHGWRA
SAERRAAVIEQPGPFKVTVSMRYDYFVLQ