Protein Info for Psyr_1294 in Pseudomonas syringae pv. syringae B728a

Annotation: regulatory protein, LuxR:Response regulator receiver

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 83 to 103 (21 residues), see Phobius details PF00072: Response_reg" amino acids 11 to 125 (115 residues), 74.6 bits, see alignment E=1.4e-24 PF00196: GerE" amino acids 159 to 213 (55 residues), 50 bits, see alignment E=3.6e-17

Best Hits

KEGG orthology group: K07687, two-component system, NarL family, captular synthesis response regulator RcsB (inferred from 100% identity to psb:Psyr_1294)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWX7 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Psyr_1294 regulatory protein, LuxR:Response regulator receiver (Pseudomonas syringae pv. syringae B728a)
MSDSADRPLRVIVADDHPIFLIGLRVVLEQNNLASVVAEACNPDELLQVLERHACDVLVT
DFMMPVERQNDGLRLLQRIRRDFPALPVIVVTTLSNAGLFQSMLDLDVRGLLSKASLAGE
LPAAIKSVRRGELFVADSVRSVLSEARQHGPDALLPADRLSPRELEVLRLLSAGHTVGQI
AAQLNRSKQTVSAQKVAAMRKLGLANDAALFIYLQESGMS