Protein Info for Psyr_1266 in Pseudomonas syringae pv. syringae B728a

Annotation: Twin-arginine translocation pathway signal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07732: Cu-oxidase_3" amino acids 53 to 160 (108 residues), 109.9 bits, see alignment E=1.3e-35 PF00394: Cu-oxidase" amino acids 345 to 454 (110 residues), 22.3 bits, see alignment E=1.8e-08 PF07731: Cu-oxidase_2" amino acids 348 to 456 (109 residues), 95.4 bits, see alignment E=3.9e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1266)

MetaCyc: 80% identical to CumA multicopper oxidase (Pseudomonas putida GB-1)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX05 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Psyr_1266 Twin-arginine translocation pathway signal (Pseudomonas syringae pv. syringae B728a)
MSFTRRQILTGIAGLAVVGLGAGGASRYWMGRRESEAGSDFVLIAAPLDVELVAGHKTPA
WAFGGSAPGTELRVRQGEWLRLRFINQLPVETTIHWHGIRLPLEMDGVPYVSQLPVKPGE
YFDYKFRVPDAGSYWYHPHVSSSEELGRGLVGPLIVEEREPTGFAYERTVSLKSWHVDEQ
GAFTEFSVLREAAREGTAGRLSTLNGIPQAVIELPAGQITRVRLLNLDNTVTYRLNLPDA
EAQIYALDGNPVKPRPFGDEYWLGPGMRICLAIKAPPAGEEISLRNGPVRLGTFRSVANN
DAPGQWPPELPANPVAEPDMANAEKINFNFEWVGSMSVNTDNGKPPSLWQINGEAWDITD
KTCADRPIARLKLGKSYIFELKNMTQYQHPIHLHGMSFKVIASNRRKIIPYFTDTFLLGR
NERARVALVADNPGVWMFHCHVIDHMETGLMAAIEVA