Protein Info for Psyr_1257 in Pseudomonas syringae pv. syringae B728a

Annotation: 2-isopropylmalate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 TIGR00970: 2-isopropylmalate synthase" amino acids 7 to 547 (541 residues), 801.1 bits, see alignment E=2.6e-245 PF00682: HMGL-like" amino acids 34 to 313 (280 residues), 250.4 bits, see alignment E=3e-78 PF22615: IPMS_D2" amino acids 330 to 393 (64 residues), 118.9 bits, see alignment E=1.4e-38 PF08502: LeuA_dimer" amino acids 422 to 547 (126 residues), 95.5 bits, see alignment E=3.6e-31

Best Hits

Swiss-Prot: 100% identical to LEU1_PSEU2: 2-isopropylmalate synthase (leuA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01649, 2-isopropylmalate synthase [EC: 2.3.3.13] (inferred from 100% identity to psb:Psyr_1257)

Predicted SEED Role

"2-isopropylmalate synthase (EC 2.3.3.13)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 2.3.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX14 at UniProt or InterPro

Protein Sequence (556 amino acids)

>Psyr_1257 2-isopropylmalate synthase (Pseudomonas syringae pv. syringae B728a)
MTMLKDPSKKYRAFPTIDLPDRTWPSKTIDAVPIWCSSDLRDGNQSLIEPMDAAKKLRFW
KTLVSVGVKEIEASFPSASQTDFDFVRTLIEDGHIPDDTTIQVLTQAREDLIARTFESLR
GAKKAIVHLYNATCPSFRRIVFNQDKAGVKEIAVNAAKLFVKYAAQQPETQWTFQYSPET
FSATELEFAKEVCDAVIEVWNPTPENKVILNLPATVEVATPNIYADQIEWFGRNITRRDS
VLISLHTHNDRGTGVAATELGLMAGADRVEGCLFGNGERTGNVDLVTVALNLYTQGINPG
LDFSDIDGVRKVVEECNQIPVHPRHPYVGDLVHTAFSGSHQDAIRKGFTQQKEGELWEVP
YLPIDPADIGRSYEAVIRVNSQSGKGGIAYLLEQEYGISLPRRMQIEFSQVVQGETDRLG
LEMTAEQIHSLLRREYLQANVPYALISHKLQEENGNSSVDAEVHVDGETQHWRGKGKGAL
EALVAGLPVAVEIMDYNEHAIGSGTTAKAAAYIELRVNGERAVHGVGIDENITTASFRAL
FSALNRSLSQTQAKAA