Protein Info for Psyr_1229 in Pseudomonas syringae pv. syringae B728a

Annotation: protein translocase subunit yajC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 42 (17 residues), see Phobius details PF02699: YajC" amino acids 26 to 100 (75 residues), 96.2 bits, see alignment E=4.4e-32 TIGR00739: preprotein translocase, YajC subunit" amino acids 26 to 103 (78 residues), 93.7 bits, see alignment E=2.8e-31

Best Hits

Swiss-Prot: 49% identical to YAJC_ECOLI: Sec translocon accessory complex subunit YajC (yajC) from Escherichia coli (strain K12)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 100% identity to psp:PSPPH_1301)

MetaCyc: 49% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX42 at UniProt or InterPro

Protein Sequence (111 amino acids)

>Psyr_1229 protein translocase subunit yajC (Pseudomonas syringae pv. syringae B728a)
MSFFISPAFADAAAPAAGPAGSGFEWIFLVGFLVIFYLMIWRPQAKRAKEQKNLLGNLQK
GDEVVTSGGIAGKINKVTDDFVVIEVSDTVELKIQKGAIAATLPKGTLKAI