Protein Info for Psyr_1216 in Pseudomonas syringae pv. syringae B728a

Annotation: type III secretion outer membrane protein PopN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR02568: type III secretion regulator YopN/LcrE/InvE/MxiC" amino acids 62 to 295 (234 residues), 189.8 bits, see alignment E=6.4e-60 PF07201: HrpJ" amino acids 71 to 234 (164 residues), 127.5 bits, see alignment E=6.7e-41 TIGR02511: type III secretion effector delivery regulator, TyeA family" amino acids 287 to 384 (98 residues), 78.1 bits, see alignment E=5e-26 PF09059: TyeA" amino acids 321 to 385 (65 residues), 21.8 bits, see alignment E=1.7e-08

Best Hits

Swiss-Prot: 98% identical to HRPJ_PSESY: Hypersensitivity response secretion protein HrpJ (hrpJ) from Pseudomonas syringae pv. syringae

KEGG orthology group: K04058, type III secretion protein SctW (inferred from 100% identity to psb:Psyr_1216)

Predicted SEED Role

"type III secretion protein HrpJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX52 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Psyr_1216 type III secretion outer membrane protein PopN (Pseudomonas syringae pv. syringae B728a)
MSLRHQGTEPGRRPTQRSHQAQNRPMKIVAPPTLPIRPVAPIRAITPAARAIPGGGLPDE
KGTSSLQVSRFAAALVQHSRILRERELIASRNALQSRAVKLGELYQLLMSASDTGLDNAA
RLLRKKLLQDNDADLEQVLEFADGDAAKAHVVLQAARKQAEDDGAEAEYVALTQTLKHLR
RQFGPRTRAGINTARAFGRQNIDNKRRTALRNLYGVAVSGQPNVTGLIEALIGEQQEPGE
FDLNLRDMRIAIADDLSAITPSASHEQLRTLMHGLTTARHVTTLLRGCEHLLGRMRKKNP
KLTVDPPAFLKHMLTLTANGMNVNQTLQLTQHIGGNRLEHQLAFLNGLRPMLMQLPILLW
RDLKSRQAALNNLLTLMAELTQKEQKQLYEGLA