Protein Info for Psyr_1190 in Pseudomonas syringae pv. syringae B728a

Annotation: type III transcriptional regulator HrpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF00158: Sigma54_activat" amino acids 23 to 176 (154 residues), 185.9 bits, see alignment E=9.5e-59 PF14532: Sigma54_activ_2" amino acids 33 to 181 (149 residues), 56.2 bits, see alignment E=9.2e-19 PF07728: AAA_5" amino acids 34 to 152 (119 residues), 35.6 bits, see alignment E=1.8e-12 PF02954: HTH_8" amino acids 262 to 302 (41 residues), 35.4 bits, see alignment 1.5e-12

Best Hits

Swiss-Prot: 90% identical to HRPR_PSESY: Pathogenicity locus probable regulatory protein HrpR (hrpR) from Pseudomonas syringae pv. syringae

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1190)

Predicted SEED Role

"Pathogenicity locus probable regulatory protein hrpR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX78 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Psyr_1190 type III transcriptional regulator HrpR (Pseudomonas syringae pv. syringae B728a)
MSTDIDNDVLTCCNVTALSAGHQIVMNSVLMDMDLLLCGETGTGKDTLASRIHELSSRTG
PFVGMNCAAIPESLAESQLFGVVNGAFTGVCRAREGYIEASSGGTLYLDEIDSMPLSLQA
KLLRVLESRGVERLGSTDFIPLDLRVIASAQRPLDELVEQGLFRRDLFFRLNVLTLQLPA
LRKRREQILPLFDQFTQDVAAESGRSVPTLDNRRVQILLSHDWPGNVRELKSAAKRFVLG
LPLLGAEPVEARDPVTGLRMQMRVIEKMLIQDALKRHRHNFDAVLEELELPRRTLYHRMK
ELGVASHIDLVAES