Protein Info for Psyr_1159 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS:GGDEF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 PF13188: PAS_8" amino acids 161 to 214 (54 residues), 24.7 bits, see alignment 5.7e-09 PF13426: PAS_9" amino acids 184 to 278 (95 residues), 73 bits, see alignment E=7.4e-24 TIGR00229: PAS domain S-box protein" amino acids 186 to 284 (99 residues), 72.7 bits, see alignment E=3.1e-24 PF08448: PAS_4" amino acids 186 to 281 (96 residues), 38.1 bits, see alignment E=5.5e-13 PF00989: PAS" amino acids 186 to 276 (91 residues), 48.2 bits, see alignment E=3.7e-16 PF08447: PAS_3" amino acids 187 to 272 (86 residues), 34.4 bits, see alignment E=7.9e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 315 to 476 (162 residues), 147.5 bits, see alignment E=3e-47 PF00990: GGDEF" amino acids 317 to 473 (157 residues), 162.5 bits, see alignment E=2.7e-51 PF00563: EAL" amino acids 494 to 730 (237 residues), 252.5 bits, see alignment E=1.2e-78

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1159)

Predicted SEED Role

"sensory box/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXA9 at UniProt or InterPro

Protein Sequence (748 amino acids)

>Psyr_1159 PAS:GGDEF (Pseudomonas syringae pv. syringae B728a)
MNPQGYEHDHVIPTNVEDVAKVLQAAAHSASCTAALLMVSSATGWEQLVSCGQSLLKADE
AWLRMVSSYGDVVLVGQDSPANAIQTNSPGTTLIYVAIRGFRHELLGAMLLSNSDGAMVL
SAAQRYALQAQAVHIRTYLQPGRDPEANNPLVTSFERLRLLESVVINANDAILITEAEPI
DLPGPRIVYCNPAFLAITGFTEEEVIGRTPRILQCEDTSRATLDIIREALSHWRPVEVEL
LNTRKDGSQFWVELSIVPVANEKGWFTHWVSVQRDITERKESQQLAQRARLEWEEKLALQ
SRLEERERMSEELTYIAFHDELTSLFNRAYLMNELTTAFETRKSRYERATVLFLDLDGFK
VVNDSMGHLAGDQLLKGVANRLQTCVRSNDVLARIGGDEFAILLMGKDQPETAVKMAERI
VSQLNTAIQIEGQDIFISCSIGIVSAGESHTKPEELLRDADVAMYSAKKQGRGRWSIFNT
SMREAAIDTLMIQNALRQALEDKDFLVFYQPIYSGNCEHLVGVEALVRWNHATMGIISPD
AFIPIAEDLGIIHELGAWVMHKACSEVQAWRKEFSHLDLRLNVNVSGKELSHPGFVDRVT
RIIASTGLPATQLQIEVTESVFLYQPDAIAEILRQIRQLGVRVALDDFGTGYSSLGYIDR
YPIDAVKIDRSFVSRMMTYERSEAIVSSILSLGRALNLDITAEGVETAEQYNLLRKMGCP
YFQGYLLNRPMRSEALLHIIKSAAECTA