Protein Info for Psyr_1156 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidase M20A, peptidase V

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01887: putative dipeptidase" amino acids 106 to 568 (463 residues), 232.3 bits, see alignment E=6.7e-73 PF01546: Peptidase_M20" amino acids 170 to 558 (389 residues), 63.7 bits, see alignment E=2.4e-21 PF07687: M20_dimer" amino acids 357 to 397 (41 residues), 29 bits, see alignment 8.9e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1156)

Predicted SEED Role

"Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXB2 at UniProt or InterPro

Protein Sequence (579 amino acids)

>Psyr_1156 Peptidase M20A, peptidase V (Pseudomonas syringae pv. syringae B728a)
MNLSLKKLAASTLILASLSSFASLANATVTAQQSAVILKTFSDTSVKDFRQFLNSLANAD
VVKTADFGPAISAFLDNKPLSAAQQNDIHRLLGLYTRMKYGSAATETLRELVAIPTVRVD
GVAQHENPAFIKIADKIKSLAEGFDLKFRNVDNRVYEVSLDGASDEVVGIHVHADVVPVT
LDNWVLPDGTRLDPFKVTLIGDRMYGRGTEDDKNGIVVALYAMKVIKEEKLPLARNFKLL
IDTTEETAGDAIPYYFERNPTPAYNLALDGGYPVVIAEKGYGTVMASFARRQAEGEGAEI
VSMTGGMATNQIPSKSVATLLTDKPAELAASLQQAGAEYVKSNGGDFEVDARVDGKDVKL
TVTGVSAHSSAPQSGVNPVARMLDFINSLQGKVALKHNQITDAARYAADNWGLDYLGSKL
GVGFSDDFMGPLTASLTYVAMDEKAFKLAVNLRVPKGKSPQVLKSEIAEKLAAWSTKTAI
KPAFDYSIAEPMYRNPEGEWVKALLAVASENLGMEHTFGTSAGATSVHSLPNGVQFGLAR
PEVKYTGHTDNEFKTTGQFLLDLQIVTEMMGRIGQLPKL