Protein Info for Psyr_1142 in Pseudomonas syringae pv. syringae B728a

Annotation: cytochrome bo3 quinol oxidase subunit 1 apoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details amino acids 417 to 440 (24 residues), see Phobius details amino acids 456 to 477 (22 residues), see Phobius details amino acids 495 to 518 (24 residues), see Phobius details amino acids 589 to 608 (20 residues), see Phobius details amino acids 610 to 630 (21 residues), see Phobius details TIGR02843: cytochrome o ubiquinol oxidase, subunit I" amino acids 2 to 647 (646 residues), 1133.9 bits, see alignment E=0 PF00115: COX1" amino acids 56 to 504 (449 residues), 482.2 bits, see alignment E=7.7e-149

Best Hits

Swiss-Prot: 86% identical to CYOB_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 1 (cyoB) from Pseudomonas putida

KEGG orthology group: K02298, cytochrome o ubiquinol oxidase subunit I [EC: 1.10.3.-] (inferred from 100% identity to psb:Psyr_1142)

MetaCyc: 87% identical to cytochrome bo terminal oxidase subunit I (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXC6 at UniProt or InterPro

Protein Sequence (670 amino acids)

>Psyr_1142 cytochrome bo3 quinol oxidase subunit 1 apoprotein (Pseudomonas syringae pv. syringae B728a)
MFGKLSLEAVPFHEPIVMVTLAMIALGGIAVVGLITYFRKWTYLWSEWLTSVDHKKIGVM
YIVVAMVMLLRGFADAIMMRTQLAMAQNGSEGFLPPEHYDQIFTAHGVIMIIFMAMPFFT
GLMNIVLPLQIGARDVAFPFLNSLSFWLLVAGMLLINISLGVGEFAKTGWVAYPPLSGLQ
YSPGVGVDYYIWALQLSGLGTTLTGVNFLVTVLKMRTPGMKLMDMPIFTWTCTWANILIV
ASFPILTATLAFLTLDRYLDFHIFTNEMGGNPMMYVNLFWAWGHPEVYILILPAFGVFSE
VISTFSGKRLFGHKSMIFASGAICILGFMVWLHHFFTMGAGANVNAFFGLATMLIAIPTG
VKLFNWLFTMYQGRLRFTAPVLWTLGFMVTFSIGGMTGVLLAIPGADFVLHNSLFVIAHF
HNVIIGGAVFGYIAGFAFWFPKAFGFTLNEKWGKAAFWFWIVGFFVAFMPLYALGFLGMT
RRLNATDMPEWNIYLDVALFGAVLIAMGIASQLIQLFVSIRDRDNNRDLTGDPWNGHTLE
WSTSSPPPFYNFAELPKADDIDPFTDAKRAGTAYKVPARYSAIHMPNNTATGLYMGMLLT
VFGFAFIWHIWWLVGASLVATIAVFVAHAVRDDQGYMVPAEDVARIEGEHHKVLAANGAY
TPVKSSLEQV