Protein Info for Psyr_1102 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 PF16703: DUF5064" amino acids 1 to 117 (117 residues), 176 bits, see alignment E=1.8e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to psp:PSPPH_1170)

Predicted SEED Role

"Acetyl-CoA carboxylase alpha subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXG6 at UniProt or InterPro

Protein Sequence (118 amino acids)

>Psyr_1102 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MYEPGHLHLTHVALQPSDISYDIHLRYNVEEDPKQGTSMHFTMQGEINGKPFEEQFQLPR
DLAFNFAHDASRIAIRHGLPNSAALPIAQHKDYDRMFADIRDKLHAKSGDPVKPEHLE