Protein Info for Psyr_1074 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter membrane protein 2, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 193 to 218 (26 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 287 to 313 (27 residues), see Phobius details amino acids 326 to 349 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 155 to 251 (97 residues), 69.7 bits, see alignment E=1.3e-23 PF00528: BPD_transp_1" amino acids 172 to 359 (188 residues), 85.2 bits, see alignment E=2.4e-28

Best Hits

Swiss-Prot: 66% identical to YHDY_ECOLI: Inner membrane amino-acid ABC transporter permease protein YhdY (yhdY) from Escherichia coli (strain K12)

KEGG orthology group: K09971, general L-amino acid transport system permease protein (inferred from 99% identity to psp:PSPPH_1132)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXJ2 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Psyr_1074 amino acid ABC transporter membrane protein 2, PAAT family (Pseudomonas syringae pv. syringae B728a)
MTTHTFKPDMPPPGKVFGPMAWMRQNLFSSWINTLLTLFSLYLIYLVVPPIISWALLDAN
WIGTTKADCTKAGACWVFIEQRFGQFMYGYFPNELRWRVDLTAILAIVGAAPLFISKFPR
KAVYGIAFLVIYPVVAFYLLHGGAFGLTNVPTSQWGGLMLTLVIATVGIVGALPLGILLA
LGRRSNMPAVRVVCVTFIEFWRGVPLITVLFMSSVMLPLFMPEGMNFDKLLRALIGVILF
QSAYIAEVVRGGMQAIPKGQYEAASAMGLGYWRSMGLVILPQALKMVIPGIVNTFIALFK
DTSLVIIIGLFDLLNSVKQATADPAWLGMATEGYVFAALVFWIFCFGMSRYSMHLERKLD
TGHKR