Protein Info for Psyr_1058 in Pseudomonas syringae pv. syringae B728a

Annotation: Parallel beta-helix repeat:Carbohydrate binding and sugar hydrolysis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF05048: NosD" amino acids 281 to 371 (91 residues), 26.2 bits, see alignment E=5e-10 amino acids 360 to 433 (74 residues), 27.4 bits, see alignment E=2.3e-10 PF13229: Beta_helix" amino acids 292 to 435 (144 residues), 50.7 bits, see alignment E=1.6e-17 TIGR03804: parallel beta-helix repeat" amino acids 388 to 431 (44 residues), 25.2 bits, see alignment 5.1e-10

Best Hits

Swiss-Prot: 92% identical to ALGG_PSESM: Mannuronan C5-epimerase (algG) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1058)

MetaCyc: 64% identical to mannuronan C5 epimerase (Pseudomonas aeruginosa)
RXN-9839 [EC: 5.1.3.37]; TRANS-RXN-269 [EC: 5.1.3.37]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXK8 at UniProt or InterPro

Protein Sequence (536 amino acids)

>Psyr_1058 Parallel beta-helix repeat:Carbohydrate binding and sugar hydrolysis (Pseudomonas syringae pv. syringae B728a)
MNSHTSNGRSRHWPHALLESALLTSALLLASGVALANAPVVPDTQKAVVKELHQAKTYTI
TSPPTAPLEMAKPVLPDLKGYTAEAALKKIVRNKPGKVTVSRMMEETGLKEFIGGDNKMA
EWVNRQRGIPQAIMISDGYVNLQDLAKKVPKQFLNEVSPGVYVARLPILIKETGTFEIDS
KTKELRLSQEKGSFIVSEGKMLITHTQVNGWSETRNSLATYRKPEEFRPFLLTWGGSETW
IANTKMASLGYDQSKSYGISISQYTPNTAKVLKRPEPTGWIIDSEFSDMWYGFYCYETRD
FVVKGNTYRDNIIYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNKSHNN
KLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNI
KLYENVAMGNGLMGVYGHIKDLSDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSP
LSVELYRVSMLMPTKEVGISLNGVLGERQDEILDLLVRQKKAVLIDPVESQTELRE