Protein Info for Psyr_1025 in Pseudomonas syringae pv. syringae B728a

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF00106: adh_short" amino acids 10 to 196 (187 residues), 143.1 bits, see alignment E=1.2e-45 PF08659: KR" amino acids 12 to 177 (166 residues), 65.3 bits, see alignment E=1.1e-21 PF13561: adh_short_C2" amino acids 16 to 195 (180 residues), 107.8 bits, see alignment E=1e-34

Best Hits

Swiss-Prot: 53% identical to Y0148_MYCTU: Putative short-chain type dehydrogenase/reductase Rv0148 (Rv0148) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1025)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXP1 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Psyr_1025 Short-chain dehydrogenase/reductase SDR (Pseudomonas syringae pv. syringae B728a)
MSESVRFDDKVVIVTGAGGGLGRAHALLFAKHGARVVVNDLGGSAHGEGASASAADCVVA
EIRAAGGTAIANHDSVTEGGRIVQHALDAFGRIDVLVNNAGILRDKTFANMEDADWDLVY
RVHVEGAYKVTHAAWPYLREQNDGRVIFTSSTSGIYGNFGQANYATAKLGLYGLTRTLAL
EGRKHRIFVNAIAPTGGTRMTEGLIPANVFELLKPELVSPLVVYLCSAQCQSSGELFEVG
GGWIGKVRWQRSQGACFDPQAGFSPEDVAAQWQAIGDFANAAHPADTGEALKEMMANLQK
YVK