Protein Info for Psyr_0992 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF1329

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07044: DUF1329" amino acids 87 to 451 (365 residues), 539.2 bits, see alignment E=6e-166

Best Hits

Swiss-Prot: 78% identical to Y3922_PSEAE: Uncharacterized protein PA3922 (PA3922) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0992)

Predicted SEED Role

"FIG002188: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXS4 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Psyr_0992 Protein of unknown function DUF1329 (Pseudomonas syringae pv. syringae B728a)
MNMKITKNLLQVGVLGISLLATGVMAAVSESEAAKLGTSLTPMGAEKAGNAANTIPAWSP
MPKNAGAVDSKGFLANPYASEKPLFIITAANVEQYKDKLAPGQYAMFKRYPDSYRIPVYP
THRGATVPDDVFAAIKKNATTSKLVGGGSGLENFDTAIPFPIPASGVEVIWNHITRYRGG
SVKRLVTQATPQPNGSYSLVYFSDQFVFRDKMRDFDPKNPGNVLFYFKQEVTAPARLAGG
VLLVHETLDQVAEPRSAWLYNAGQRRVRRAPQVSYDGPGTASDGLRTSDNLDMYNGAPDR
YDWKLIGKQEMYIAANSHKLDDPTLKYADIIKAGHINQDLTRYELRRVWHVTATLKEGQR
HIYAKRDFFIDEDTWQAAVIDHYDGRGQLWRVAEAHSENYYDKQVPWYAVETLYDLQSGR
YVALGMKNEEKKAYEFGFTAGTSDFTPNALRQEGVR