Protein Info for Psyr_0973 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid ABC transporter membrane protein, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 108 to 134 (27 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 73 to 167 (95 residues), 93.9 bits, see alignment E=3.7e-31 PF00528: BPD_transp_1" amino acids 92 to 271 (180 residues), 75.6 bits, see alignment E=2.2e-25

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to psb:Psyr_0973)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXU3 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Psyr_0973 amino acid ABC transporter membrane protein, PAAT family (Pseudomonas syringae pv. syringae B728a)
MTSFQPQRPPEQAEQAEQSLLKRVFGFRTRLYLTWLVMFVLFAGFFLSFDLKLSIILDKL
PNLIGLHLAPNGFLQGAALTLFVSVCSIVVSVVLGFVTALARLSSSAVAFGIASFYASFF
RGTPLLIQILLIYLGLPQLGIVPGAITAGVIALSLNYGAYLSEIFRAGIIGVSVGQREAA
LALALRPTQIFWRVTLPQAMRTIIPPTTNQFISMLKDSSLISVMGVWEVMFLAQSYGRSS
YRYIEMLTTAAVLYWIMSIGLELLQSRLERHYGKAYQARK