Protein Info for Psyr_0956 in Pseudomonas syringae pv. syringae B728a

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF02353: CMAS" amino acids 136 to 403 (268 residues), 297.3 bits, see alignment E=2.6e-92 PF13489: Methyltransf_23" amino acids 180 to 300 (121 residues), 28.1 bits, see alignment E=3.9e-10 PF13649: Methyltransf_25" amino acids 197 to 290 (94 residues), 39.3 bits, see alignment E=2.2e-13 PF08242: Methyltransf_12" amino acids 197 to 291 (95 residues), 30.3 bits, see alignment E=1.5e-10 PF08241: Methyltransf_11" amino acids 197 to 293 (97 residues), 29.3 bits, see alignment E=2.8e-10

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to psb:Psyr_0956)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79), plant type" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXW0 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Psyr_0956 Cyclopropane-fatty-acyl-phospholipid synthase (Pseudomonas syringae pv. syringae B728a)
MKSSSSSFSANLGTNGLTANLLRRGVLRQLAGLRNGQLVIVERGERHVFGKNGALIQAEI
HLLDSAAWGMVASNGSIGAGEAFIHGYWTTPDLTAVIRVFVSNLDVLDAMEGGMARLTRP
LIHALHWLNRNTREGSQKNIAAHYDLGNTLFEQFLDPTMMYSAAQFLSEDDTLEQAQLNK
LERICQKLALKPTDHLLEIGTGWGSMAIYAAQHYGCRVTTTTLSKEQFAYTERRLIELGL
QDRVTLLLTDYRDLTGEYDKLVSIEMIEAVGHRFLPTYFKQCANLLKSNGMMLLQAITIR
EQRYAQAKRTVDFIQRYIFPGGALPSVAKMLDIVGSDTDMNLLHMEDFGLHYARTLRLWH
DNFKNAHGKLAELGYDEHFLRLWEFYLCYCEGGFLERTIGTAQLLLAKPEALREPLLGRF
NA