Protein Info for Psyr_0950 in Pseudomonas syringae pv. syringae B728a

Annotation: [protein release factor]-glutamine N5-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF17827: PrmC_N" amino acids 12 to 72 (61 residues), 64.5 bits, see alignment E=6e-21 TIGR00536: methyltransferase, HemK family" amino acids 18 to 274 (257 residues), 263.8 bits, see alignment E=1.5e-82 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 22 to 271 (250 residues), 299.5 bits, see alignment E=2e-93 PF03602: Cons_hypoth95" amino acids 91 to 189 (99 residues), 30.6 bits, see alignment E=1.5e-10 PF01170: UPF0020" amino acids 97 to 186 (90 residues), 26 bits, see alignment E=4e-09 PF13489: Methyltransf_23" amino acids 103 to 238 (136 residues), 35.4 bits, see alignment E=4.8e-12 PF05175: MTS" amino acids 109 to 193 (85 residues), 64.9 bits, see alignment E=4e-21 PF06325: PrmA" amino acids 110 to 183 (74 residues), 27 bits, see alignment E=1.7e-09 PF13847: Methyltransf_31" amino acids 111 to 184 (74 residues), 51.9 bits, see alignment E=4.1e-17 PF13649: Methyltransf_25" amino acids 113 to 188 (76 residues), 38.4 bits, see alignment E=9.2e-13 PF08242: Methyltransf_12" amino acids 114 to 183 (70 residues), 31.3 bits, see alignment E=1.6e-10 PF08241: Methyltransf_11" amino acids 114 to 183 (70 residues), 26.9 bits, see alignment E=3.4e-09

Best Hits

Swiss-Prot: 70% identical to PRMC_PSEAE: Release factor glutamine methyltransferase (prmC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to psb:Psyr_0950)

MetaCyc: 50% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXW6 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Psyr_0950 [protein release factor]-glutamine N5-methyltransferase (Pseudomonas syringae pv. syringae B728a)
MTIIASVLRSAELPDSPTARLDAELLLAAALGKPRSFLHTWPERIVSTEAAVAFAGYMER
RRKGEPVAYILGQQGFWKLDLEVAPHTLIPRPETEMLVEAALELVPAFAPAQVLDLGTGT
GAIALALANDRQQWKVTAVDRVPEAVALAERNRQRLQLNNAEVFESHWFSGLQGRQFDLI
ISNPPYISDADPHLSAGDVRFEPSSALVAGSDGLDDLRTIIEQAPAHLNADGWLLLEHGY
DQGPAVRELLIRQGFERIQTRRDLGEHERITFGCKPC