Protein Info for Psyr_0946 in Pseudomonas syringae pv. syringae B728a

Annotation: Outer membrane lipoprotein LolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00548: outer membrane lipoprotein LolB" amino acids 4 to 200 (197 residues), 264.6 bits, see alignment E=2.6e-83 PF03550: LolB" amino acids 48 to 198 (151 residues), 171.1 bits, see alignment E=8.7e-55

Best Hits

Swiss-Prot: 100% identical to LOLB_PSEU2: Outer-membrane lipoprotein LolB (lolB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02494, outer membrane lipoprotein LolB (inferred from 100% identity to psb:Psyr_0946)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXX0 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Psyr_0946 Outer membrane lipoprotein LolB (Pseudomonas syringae pv. syringae B728a)
MFLRHVIVFSLIALLTGCAGLTSREAVQGKGDPAQWREHKQQLSSLDGWQINGKVGIRAP
KDSGSGTLFWLQRQDYYDIRLSGPLGRGAARLTGRPGAVVLEVANQGRYEATSPESLLQD
QLGWKLPVSHLVWWVRGLPAPDSKSNVTLDGDSRLASLEQDGWQVEYLSYVEQNGYWLPE
RVKLHGQDLDVTLVIKDWQPRKLGQ