Protein Info for Psyr_0916 in Pseudomonas syringae pv. syringae B728a

Annotation: GDP-mannose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 185 (185 residues), 30.1 bits, E=4e-11
• TIGR01472: GDP-mannose 4,6-dehydratase
  • amino acids 2 to 335 (334 residues), 483.9 bits, E=1.4e-149
• PF01370: Epimerase
  • amino acids 4 to 244 (241 residues), 230.7 bits, E=2.6e-72
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 329 (326 residues), 464.6 bits, E=3.5e-143

Best Hits

Swiss-Prot: 73% identical to GM4D_AGGAC: GDP-mannose 4,6-dehydratase (gmd) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 100% identity to psp:PSPPH_0953)

MetaCyc: 73% identical to GDP-alpha-D-mannose 4,6-dehydratase (Aggregatibacter actinomycetemcomitans)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• GDP-6-deoxy-D-talose biosynthesis (1/2 steps found)
• GDP-D-perosamine biosynthesis (1/2 steps found)
• GDP-D-rhamnose biosynthesis (1/2 steps found)
• GDP-L-colitose biosynthesis (3/5 steps found)
• GDP-N-acetyl-α-D-perosamine biosynthesis (1/3 steps found)
• GDP-N-formyl-α-D-perosamine biosynthesis (1/3 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (1/3 steps found)
• GDP-mycosamine biosynthesis (1/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (7/14 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

See Q4ZXZ8 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Psyr_0916 GDP-mannose 4,6-dehydratase (Pseudomonas syringae pv. syringae B728a)
MKAIITGITGQDGAYLAELLLEKGYTVYGTYRRTSSVNFWRIEELGIQNNPNLHLVEYDL
TDLSASIRLLQTTGATEVYNLAAQSFVGVSFEQPLTTAEITGIGAVNLLEAIRIVNTKIR
FYQASTSEMFGKVQAIPQVESTPFYPRSPYGVAKLYAHWMTINYRESYDIFATSGILFNH
ESPLRGREFVTRKITDSVAKIKLGLIESFELGNMDAKRDWGFAKEYVEGMWRMLQADEPD
TFVLATNRTETVRDFVSMAFKATGVTIKWEGEAESEKGICADTGKVLVSVNPKFYRPTEV
ELLIGNPAKAKEVLGWEPKTNLEELCRMMVEADLRRNEKGFSF