Protein Info for Psyr_0864 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF393

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 83 to 103 (21 residues), see Phobius details PF04134: DCC1-like" amino acids 16 to 125 (110 residues), 108.2 bits, see alignment E=2.9e-35

Best Hits

Swiss-Prot: 44% identical to YUXK_BACSU: Uncharacterized protein YuxK (yuxK) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0864)

Predicted SEED Role

"probable membrane protein YPO1564"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY50 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Psyr_0864 Protein of unknown function DUF393 (Pseudomonas syringae pv. syringae B728a)
MPKTPAPYLKPDECVVLFDGVCKLCNGVVKFLIRHDPHQRLRLAAVQSEQGQALLKWAGL
PLDDFHTIAVIVNNRVFVRSDAFLHIMGLLPAPWPLLKVLGIFPRFLRDWAYNRIALNRY
RLFGRYDHCLLPSPEDRQRFLGD